Lineage for d4a8ta2 (4a8t A:149-317)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1620378Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1620379Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1620829Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1620830Protein automated matches [226938] (22 species)
    not a true protein
  7. 1620896Species Enterococcus faecalis [TaxId:1351] [226301] (1 PDB entry)
  8. 1620898Domain d4a8ta2: 4a8t A:149-317 [218717]
    automated match to d1dxha2
    complexed with ni, pao, pge

Details for d4a8ta2

PDB Entry: 4a8t (more details), 1.59 Å

PDB Description: Crystal structure of putrescine transcarbamylase from Enterococcus faecalis lacking its C-terminal Helix, with bound N5-(phosphonoacetyl) -L-ornithine
PDB Compounds: (A:) Putrescine carbamoyltransferase

SCOPe Domain Sequences for d4a8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a8ta2 c.78.1.0 (A:149-317) automated matches {Enterococcus faecalis [TaxId: 1351]}
kkledckvvfvgdatqvcfslglittkmgmnfvhfgpegfqlneehqaklakncevsggs
flvtddassvegadflytdvwyglyeaelseeermkvfypkyqvnqemmdraganckfmh
clpatrgeevtdevidgknsicfdeaenrltsirgllvylmndyeaknp

SCOPe Domain Coordinates for d4a8ta2:

Click to download the PDB-style file with coordinates for d4a8ta2.
(The format of our PDB-style files is described here.)

Timeline for d4a8ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a8ta1