SCOPe 2.05: Domain d4a8ta2: 4a8t A:149-317

Lineage for d4a8ta2 (4a8t A:149-317)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [226301] (1 PDB entry)

8. Domain d4a8ta2: 4a8t A:149-317 [218717]
   automated match to d1dxha2
   complexed with ni, pao, pge

Details for d4a8ta2

PDB Entry: 4a8t, 1.59 Å

PDB Description: Crystal structure of putrescine transcarbamylase from Enterococcus faecalis lacking its C-terminal Helix, with bound N5-(phosphonoacetyl) -L-ornithine

PDB Compounds: (A:) Putrescine carbamoyltransferase

SCOPe Domain Sequences for d4a8ta2:

Sequence; same for both SEQRES and ATOM records:

>d4a8ta2 c.78.1.0 (A:149-317) automated matches {Enterococcus faecalis [TaxId: 1351]}
kkledckvvfvgdatqvcfslglittkmgmnfvhfgpegfqlneehqaklakncevsggs
flvtddassvegadflytdvwyglyeaelseeermkvfypkyqvnqemmdraganckfmh
clpatrgeevtdevidgknsicfdeaenrltsirgllvylmndyeaknp

Timeline for d4a8ta2:

• d4a8ta2 first appeared in SCOPe 2.03
  
• d4a8ta2 appears in SCOPe 2.04
  
• d4a8ta2 appears in SCOPe 2.06
  
• d4a8ta2 appears in the current release, SCOPe 2.08