Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein) automatically mapped to Pfam PF03723 |
Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species) elaborated with many loop insertions in the common fold |
Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (2 PDB entries) |
Domain d1hcya3: 1hcy A:399-653 [21871] Other proteins in same PDB: d1hcya1, d1hcya2, d1hcyb1, d1hcyb2, d1hcyc1, d1hcyc2, d1hcyd1, d1hcyd2, d1hcye1, d1hcye2, d1hcyf1, d1hcyf2 complexed with cu |
PDB Entry: 1hcy (more details), 3.2 Å
SCOPe Domain Sequences for d1hcya3:
Sequence, based on SEQRES records: (download)
>d1hcya3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg vsnikhvvvkivhhl
>d1hcya3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm efnlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvv kivhhl
Timeline for d1hcya3: