Lineage for d1hcy_3 (1hcy 399-653)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 protein domains)
  6. 9683Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 9689Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries)
  8. 9696Domain d1hcy_3: 1hcy 399-653 [21871]
    Other proteins in same PDB: d1hcy_1, d1hcy_2

Details for d1hcy_3

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_3:

Sequence, based on SEQRES records: (download)

>d1hcy_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records): (download)

>d1hcy_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvv
kivhhl

SCOP Domain Coordinates for d1hcy_3:

Click to download the PDB-style file with coordinates for d1hcy_3.
(The format of our PDB-style files is described here.)

Timeline for d1hcy_3: