Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries) |
Domain d4a79a2: 4a79 A:290-401 [218681] Other proteins in same PDB: d4a79a1, d4a79b1 automated match to d1s3ea2 complexed with fad, p1b |
PDB Entry: 4a79 (more details), 1.89 Å
SCOPe Domain Sequences for d4a79a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a79a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d4a79a2: