SCOPe 2.07: Domain d4a6yl2: 4a6y L:111-211

Lineage for d4a6yl2 (4a6y L:111-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4a6yl2: 4a6y L:111-211 [218679]
   Other proteins in same PDB: d4a6ya1, d4a6yl1
   automated match to d1q0xl2

Details for d4a6yl2

PDB Entry: 4a6y, 2.9 Å

PDB Description: crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3

PDB Compounds: (L:) antibody bbe6.12h3 light chain

SCOPe Domain Sequences for d4a6yl2:

Sequence; same for both SEQRES and ATOM records:

>d4a6yl2 b.1.1.2 (L:111-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d4a6yl2:

• d4a6yl2 first appeared in SCOPe 2.03
  
• d4a6yl2 appears in SCOPe 2.06
  
• d4a6yl2 appears in the current release, SCOPe 2.08