Lineage for d4a2ba1 (4a2b A:7-199)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605284Protein Cell division protein FtsA [53078] (1 species)
  7. 1605285Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries)
  8. 1605286Domain d4a2ba1: 4a2b A:7-199 [218631]
    automated match to d1e4gt1
    complexed with ags, mg

Details for d4a2ba1

PDB Entry: 4a2b (more details), 1.8 Å

PDB Description: Thermotoga maritima FtsA with ATP gamma S
PDB Compounds: (A:) cell division protein ftsa, putative

SCOPe Domain Sequences for d4a2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2ba1 c.55.1.1 (A:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
lksslvstaegvl

SCOPe Domain Coordinates for d4a2ba1:

Click to download the PDB-style file with coordinates for d4a2ba1.
(The format of our PDB-style files is described here.)

Timeline for d4a2ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a2ba2