![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Cell division protein FtsA [53078] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries) |
![]() | Domain d1e4gt1: 1e4g T:6-199 [33455] complexed with atp, mg |
PDB Entry: 1e4g (more details), 2.6 Å
SCOPe Domain Sequences for d1e4gt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4gt1 c.55.1.1 (T:6-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} ktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllk eleeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklken gktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspf qlksslvstaegvl
Timeline for d1e4gt1: