SCOPe 2.06: Domain d3zv2a_: 3zv2 A:

Lineage for d3zv2a_ (3zv2 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (28 PDB entries)

8. Domain d3zv2a_: 3zv2 A: [218528]
   automated match to d1eena_
   mutant

Details for d3zv2a_

PDB Entry: 3zv2, 2.8 Å

PDB Description: human protein-tyrosine phosphatase 1b c215a, s216a mutant

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d3zv2a_:

Sequence; same for both SEQRES and ATOM records:

>d3zv2a_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhaaagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Timeline for d3zv2a_:

• d3zv2a_ first appeared in SCOPe 2.03
  
• d3zv2a_ appears in SCOPe 2.05
  
• d3zv2a_ appears in SCOPe 2.07
  
• d3zv2a_ appears in the current release, SCOPe 2.08