Lineage for d1dedb1 (1ded B:497-582)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223333Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 223365Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (4 PDB entries)
  8. 223373Domain d1dedb1: 1ded B:497-582 [21851]
    Other proteins in same PDB: d1deda2, d1deda3, d1deda4, d1dedb2, d1dedb3, d1dedb4
    complexed with acr, ca; mutant

Details for d1dedb1

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1dedb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dedb1 b.1.18.2 (B:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOP Domain Coordinates for d1dedb1:

Click to download the PDB-style file with coordinates for d1dedb1.
(The format of our PDB-style files is described here.)

Timeline for d1dedb1: