Lineage for d3zrce_ (3zrc E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647482Protein Elongin C [54699] (3 species)
  7. 1647485Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries)
  8. 1647541Domain d3zrce_: 3zrc E: [218408]
    Other proteins in same PDB: d3zrca_, d3zrcc_, d3zrcd_, d3zrcf_, d3zrcg_, d3zrci_, d3zrcj_, d3zrcl_
    automated match to d2c9wc_
    complexed with l8b

Details for d3zrce_

PDB Entry: 3zrc (more details), 2.9 Å

PDB Description: pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
PDB Compounds: (E:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3zrce_:

Sequence, based on SEQRES records: (download)

>d3zrce_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d3zrce_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d3zrce_:

Click to download the PDB-style file with coordinates for d3zrce_.
(The format of our PDB-style files is described here.)

Timeline for d3zrce_: