Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries) |
Domain d3zrcb_: 3zrc B: [218405] Other proteins in same PDB: d3zrca_, d3zrcc_, d3zrcd_, d3zrcf_, d3zrcg_, d3zrci_, d3zrcj_, d3zrcl_ automated match to d2c9wc_ complexed with l8b |
PDB Entry: 3zrc (more details), 2.9 Å
SCOPe Domain Sequences for d3zrcb_:
Sequence, based on SEQRES records: (download)
>d3zrcb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d3zrcb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns steipefpiapeialellmaanfldc
Timeline for d3zrcb_: