![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Nitrosomonas europaea [TaxId:915] [224844] (2 PDB entries) |
![]() | Domain d3zoxd_: 3zox D: [218386] automated match to d1ynrb_ complexed with hec; mutant |
PDB Entry: 3zox (more details), 2.1 Å
SCOPe Domain Sequences for d3zoxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zoxd_ a.3.1.0 (D:) automated matches {Nitrosomonas europaea [TaxId: 915]} dadlakknnciachqvetkvvgpalkdiaakyadkddaatylagkikggssgvwgqipmp pvnvsdadakaladwiltlk
Timeline for d3zoxd_: