Lineage for d3zoxa_ (3zox A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691690Species Nitrosomonas europaea [TaxId:915] [224844] (2 PDB entries)
  8. 2691695Domain d3zoxa_: 3zox A: [218383]
    automated match to d1ynrb_
    complexed with hec; mutant

Details for d3zoxa_

PDB Entry: 3zox (more details), 2.1 Å

PDB Description: Crystal Structure of N64Del Mutant of Nitrosomonas europaea Cytochrome c552 (monoclinic space group)
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3zoxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zoxa_ a.3.1.0 (A:) automated matches {Nitrosomonas europaea [TaxId: 915]}
dadlakknnciachqvetkvvgpalkdiaakyadkddaatylagkikggssgvwgqipmp
pvnvsdadakaladwiltlk

SCOPe Domain Coordinates for d3zoxa_:

Click to download the PDB-style file with coordinates for d3zoxa_.
(The format of our PDB-style files is described here.)

Timeline for d3zoxa_: