Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) |
Domain d6cgt_1: 6cgt 495-579 [21837] Other proteins in same PDB: d6cgt_2, d6cgt_3, d6cgt_4 complexed with ca, dag, glc, opg; mutant |
PDB Entry: 6cgt (more details), 2.6 Å
SCOP Domain Sequences for d6cgt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cgt_1 b.1.18.2 (495-579) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains} ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips vaagnyavkvaasgvnsnaynnfti
Timeline for d6cgt_1: