Lineage for d1cxka1 (1cxk A:497-583)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223333Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 223334Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 223352Domain d1cxka1: 1cxk A:497-583 [21835]
    Other proteins in same PDB: d1cxka2, d1cxka3, d1cxka4
    complexed with ca, glc; mutant

Details for d1cxka1

PDB Entry: 1cxk (more details), 2.09 Å

PDB Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n

SCOP Domain Sequences for d1cxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxka1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

SCOP Domain Coordinates for d1cxka1:

Click to download the PDB-style file with coordinates for d1cxka1.
(The format of our PDB-style files is described here.)

Timeline for d1cxka1: