Lineage for d3zeta2 (3zet A:108-229)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606457Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries)
  8. 1606463Domain d3zeta2: 3zet A:108-229 [218276]
    automated match to d1okja2
    complexed with amp, cd, tam

Details for d3zeta2

PDB Entry: 3zet (more details), 2.31 Å

PDB Description: Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer
PDB Compounds: (A:) putative m22 peptidase yeaz

SCOPe Domain Sequences for d3zeta2:

Sequence, based on SEQRES records: (download)

>d3zeta2 c.55.1.0 (A:108-229) automated matches {Salmonella enterica [TaxId: 909946]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvylrnevawkkl
pg

Sequence, based on observed residues (ATOM records): (download)

>d3zeta2 c.55.1.0 (A:108-229) automated matches {Salmonella enterica [TaxId: 909946]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlagltlhdgevslpaaedmlpiasqklaagetvavehaepvylrnevawkklpg

SCOPe Domain Coordinates for d3zeta2:

Click to download the PDB-style file with coordinates for d3zeta2.
(The format of our PDB-style files is described here.)

Timeline for d3zeta2: