SCOPe 2.08: Domain d3zeta2: 3zet A:108-229

Lineage for d3zeta2 (3zet A:108-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries)

8. Domain d3zeta2: 3zet A:108-229 [218276]
   automated match to d1okja2
   complexed with amp, cd, tam

Details for d3zeta2

PDB Entry: 3zet, 2.31 Å

PDB Description: Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer

PDB Compounds: (A:) putative m22 peptidase yeaz

SCOPe Domain Sequences for d3zeta2:

Sequence, based on SEQRES records:

>d3zeta2 c.55.1.0 (A:108-229) automated matches {Salmonella enterica [TaxId: 909946]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvylrnevawkkl
pg

Sequence, based on observed residues (ATOM records):

>d3zeta2 c.55.1.0 (A:108-229) automated matches {Salmonella enterica [TaxId: 909946]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlagltlhdgevslpaaedmlpiasqklaagetvavehaepvylrnevawkklpg

Timeline for d3zeta2:

• d3zeta2 first appeared in SCOPe 2.03
  
• d3zeta2 appears in SCOPe 2.07