Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries) |
Domain d1cxha1: 1cxh A:496-581 [21821] Other proteins in same PDB: d1cxha2, d1cxha3, d1cxha4 complexed with ca, mal |
PDB Entry: 1cxh (more details), 2.41 Å
SCOPe Domain Sequences for d1cxha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxha1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa vaggnynikvanaagtasnvydnfev
Timeline for d1cxha1: