Lineage for d1cxha1 (1cxh A:496-581)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111680Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1111725Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 1111726Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 1111755Domain d1cxha1: 1cxh A:496-581 [21821]
    Other proteins in same PDB: d1cxha2, d1cxha3, d1cxha4
    complexed with ca, mal

Details for d1cxha1

PDB Entry: 1cxh (more details), 2.41 Å

PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1cxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxha1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOPe Domain Coordinates for d1cxha1:

Click to download the PDB-style file with coordinates for d1cxha1.
(The format of our PDB-style files is described here.)

Timeline for d1cxha1: