Lineage for d1cxh_1 (1cxh 496-581)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries) 
Domain d1cxh_1: 1cxh 496-581 [21821]
Other proteins in same PDB: d1cxh_2, d1cxh_3, d1cxh_4
Details for d1cxh_1
PDB Entry: 1cxh (more details), 2.4 Å
PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose
SCOP Domain Sequences for d1cxh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxh_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev
SCOP Domain Coordinates for d1cxh_1:
Click to download the PDB-style file with coordinates for d1cxh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxh_1:
- d1cxh_1 appears in SCOP 1.57
- d1cxh_1 appears in the current release, SCOPe 2.08, called d1cxha1
View in 3D
