![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [226729] (1 PDB entry) |
![]() | Domain d3w0la1: 3w0l A:6-211 [218179] automated match to d1bdga1 complexed with f6r, na, so4 |
PDB Entry: 3w0l (more details), 2.92 Å
SCOPe Domain Sequences for d3w0la1:
Sequence, based on SEQRES records: (download)
>d3w0la1 c.55.1.0 (A:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipvdamtgtaemlfdyiaecisd yldqqnmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrr gdfemdvvamvndtvatmiscyyedh
>d3w0la1 c.55.1.0 (A:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipvdamtgtaemlfdyiaecisd yldqqnmkhkklplgftfsfpvrnnvvgllrdaikrrgdfemdvvamvndtvatmiscyy edh
Timeline for d3w0la1: