Lineage for d3w0la1 (3w0l A:6-211)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858521Species African clawed frog (Xenopus laevis) [TaxId:8355] [226729] (1 PDB entry)
  8. 1858522Domain d3w0la1: 3w0l A:6-211 [218179]
    automated match to d1bdga1
    complexed with f6r, na, so4

Details for d3w0la1

PDB Entry: 3w0l (more details), 2.92 Å

PDB Description: The crystal structure of Xenopus Glucokinase and Glucokinase Regulatory Protein complex
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3w0la1:

Sequence, based on SEQRES records: (download)

>d3w0la1 c.55.1.0 (A:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg
dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipvdamtgtaemlfdyiaecisd
yldqqnmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrr
gdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records): (download)

>d3w0la1 c.55.1.0 (A:6-211) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnevdqilsefhlqeedlhvlmcrmqaemerglhletneeasvkmlptyvrstpdgsevg
dflaldlggtnfrvmlvkvgedlegqwkvetkhkmysipvdamtgtaemlfdyiaecisd
yldqqnmkhkklplgftfsfpvrnnvvgllrdaikrrgdfemdvvamvndtvatmiscyy
edh

SCOPe Domain Coordinates for d3w0la1:

Click to download the PDB-style file with coordinates for d3w0la1.
(The format of our PDB-style files is described here.)

Timeline for d3w0la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w0la2