Lineage for d3vzsd1 (3vzs D:2-246)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107538Species Cupriavidus necator [TaxId:381666] [224880] (4 PDB entries)
  8. 2107546Domain d3vzsd1: 3vzs D:2-246 [218171]
    Other proteins in same PDB: d3vzsb2, d3vzsd2
    automated match to d3ennd_
    complexed with caa, nap, so4

Details for d3vzsd1

PDB Entry: 3vzs (more details), 2.14 Å

PDB Description: crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and nadp
PDB Compounds: (D:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3vzsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzsd1 c.2.1.0 (D:2-246) automated matches {Cupriavidus necator [TaxId: 381666]}
tqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegn
vadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtk
qvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntv
spgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslng
glhmg

SCOPe Domain Coordinates for d3vzsd1:

Click to download the PDB-style file with coordinates for d3vzsd1.
(The format of our PDB-style files is described here.)

Timeline for d3vzsd1: