SCOPe 2.05: Domain d3vzsd_: 3vzs D:

Lineage for d3vzsd_ (3vzs D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Cupriavidus necator [TaxId:381666] [224880] (4 PDB entries)

8. Domain d3vzsd_: 3vzs D: [218171]
   automated match to d3ennd_
   complexed with caa, nap, so4

Details for d3vzsd_

PDB Entry: 3vzs, 2.14 Å

PDB Description: crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and nadp

PDB Compounds: (D:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3vzsd_:

Sequence; same for both SEQRES and ATOM records:

>d3vzsd_ c.2.1.0 (D:) automated matches {Cupriavidus necator [TaxId: 381666]}
hhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfia
segnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslf
nvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvt
vntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadf
slngglhmg

Timeline for d3vzsd_:

• d3vzsd_ first appeared in SCOPe 2.03
  
• d3vzsd_ appears in SCOPe 2.04
  
• d3vzsd_ is called d3vzsd1 in SCOPe 2.06
  
• d3vzsd_ appears in the current release, SCOPe 2.08, called d3vzsd1