Lineage for d3vyua_ (3vyu A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2061119Superfamily b.40.14: HupF/HypC-like [159127] (1 family) (S)
    contains extra C-terminal helix packed against the beta-barrel side
    automatically mapped to Pfam PF01455
  5. 2061120Family b.40.14.1: HupF/HypC-like [159128] (1 protein)
    Pfam PF01455
  6. 2061121Protein Hydrogenase expression/formation protein HypC [159129] (3 species)
  7. 2061127Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries)
    Uniprot Q5JII0 2-72
  8. 2061134Domain d3vyua_: 3vyu A: [218153]
    Other proteins in same PDB: d3vyuc1, d3vyuc2
    automated match to d3vysa_
    complexed with sf4

Details for d3vyua_

PDB Entry: 3vyu (more details), 2.75 Å

PDB Description: Crystal structure of the HypC-HypD-HypE complex (form II)
PDB Compounds: (A:) Hydrogenase expression/formation protein HypC

SCOPe Domain Sequences for d3vyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vyua_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]}
lavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldek

SCOPe Domain Coordinates for d3vyua_:

Click to download the PDB-style file with coordinates for d3vyua_.
(The format of our PDB-style files is described here.)

Timeline for d3vyua_: