| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.14: HupF/HypC-like [159127] (1 family) ![]() contains extra C-terminal helix packed against the beta-barrel side automatically mapped to Pfam PF01455 |
| Family b.40.14.1: HupF/HypC-like [159128] (1 protein) Pfam PF01455 |
| Protein Hydrogenase expression/formation protein HypC [159129] (3 species) |
| Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries) Uniprot Q5JII0 2-72 |
| Domain d3vyua_: 3vyu A: [218153] Other proteins in same PDB: d3vyuc1, d3vyuc2 automated match to d3vysa_ complexed with sf4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3vyu (more details), 2.75 Å
SCOPe Domain Sequences for d3vyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vyua_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]}
lavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldek
Timeline for d3vyua_: