Lineage for d3vwkc2 (3vwk C:118-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751672Domain d3vwkc2: 3vwk C:118-204 [218129]
    Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc1, d3vwkd1
    automated match to d1qrnd2
    complexed with 4gh, mg, nag

Details for d3vwkc2

PDB Entry: 3vwk (more details), 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex
PDB Compounds: (C:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3vwkc2:

Sequence, based on SEQRES records: (download)

>d3vwkc2 b.1.1.2 (C:118-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records): (download)

>d3vwkc2 b.1.1.2 (C:118-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdssvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavawsn
ksdfacanafnnsiipedtff

SCOPe Domain Coordinates for d3vwkc2:

Click to download the PDB-style file with coordinates for d3vwkc2.
(The format of our PDB-style files is described here.)

Timeline for d3vwkc2: