SCOPe 2.08: Domain d3vwkd1: 3vwk D:3-118

Lineage for d3vwkd1 (3vwk D:3-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3vwkd1: 3vwk D:3-118 [218130]
   Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc2, d3vwkd2
   automated match to d1ktke1
   complexed with 4gh, mg, nag

Details for d3vwkd1

PDB Entry: 3vwk, 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex

PDB Compounds: (D:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3vwkd1:

Sequence; same for both SEQRES and ATOM records:

>d3vwkd1 b.1.1.0 (D:3-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
estvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvte

Timeline for d3vwkd1:

• d3vwkd1 first appeared in SCOPe 2.03
  
• d3vwkd1 appears in SCOPe 2.07