![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1204 PDB entries) |
![]() | Domain d3vwkd2: 3vwk D:119-246 [218131] Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc1, d3vwkd1 automated match to d1ktke2 complexed with 4gh, mg, nag |
PDB Entry: 3vwk (more details), 2.94 Å
SCOPe Domain Sequences for d3vwkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vwkd2 b.1.1.2 (D:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d3vwkd2: