Lineage for d3vwkd2 (3vwk D:119-246)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (733 PDB entries)
  8. 2353084Domain d3vwkd2: 3vwk D:119-246 [218131]
    Other proteins in same PDB: d3vwka1, d3vwka2, d3vwkb_, d3vwkc1, d3vwkd1
    automated match to d1ktke2
    complexed with 4gh, mg, nag

Details for d3vwkd2

PDB Entry: 3vwk (more details), 2.94 Å

PDB Description: Ternary crystal structure of the human NKT TCR-CD1d-4'deoxy-alpha-galactosylceramide complex
PDB Compounds: (D:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3vwkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vwkd2 b.1.1.2 (D:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3vwkd2:

Click to download the PDB-style file with coordinates for d3vwkd2.
(The format of our PDB-style files is described here.)

Timeline for d3vwkd2: