SCOPe 2.08: Domain d1c7sa1: 1c7s A:781-885

Lineage for d1c7sa1 (1c7s A:781-885)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
   rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases

7. Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)

8. Domain d1c7sa1: 1c7s A:781-885 [21812]
   Other proteins in same PDB: d1c7sa2, d1c7sa3, d1c7sa4
   complexed with so4; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1c7sa1

PDB Entry: 1c7s, 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)

PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d1c7sa1:

Sequence; same for both SEQRES and ATOM records:

>d1c7sa1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens [TaxId: 615]}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

Timeline for d1c7sa1:

• d1c7sa1 first appeared (with stable ids) in SCOP 1.55
  
• d1c7sa1 appears in SCOPe 2.07