SCOPe 2.05: Domain d1gofa1: 1gof A:538-639

Lineage for d1gofa1 (1gof A:538-639)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (3 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Dactylium dendroides [TaxId:5132] [49210] (3 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1gofa1: 1gof A:538-639 [21807]
   Other proteins in same PDB: d1gofa2, d1gofa3
   complexed with acy, cu, na

Details for d1gofa1

PDB Entry: 1gof, 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1gofa1:

Sequence; same for both SEQRES and ATOM records:

>d1gofa1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d1gofa1:

• d1gofa1 first appeared (with stable ids) in SCOP 1.55, called d1gof_1
  
• d1gofa1 appears in SCOPe 2.04
  
• d1gofa1 appears in SCOPe 2.06
  
• d1gofa1 appears in the current release, SCOPe 2.08