SCOPe 2.05: Domain d1gofa2: 1gof A:1-150

Lineage for d1gofa2 (1gof A:1-150)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
   automatically mapped to Pfam PF00754

6. Protein Galactose oxidase, N-terminal domain [49787] (3 species)

7. Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1gofa2: 1gof A:1-150 [23709]
   Other proteins in same PDB: d1gofa1, d1gofa3
   complexed with acy, cu, na

Details for d1gofa2

PDB Entry: 1gof, 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1gofa2:

Sequence; same for both SEQRES and ATOM records:

>d1gofa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

Timeline for d1gofa2:

• d1gofa2 first appeared (with stable ids) in SCOP 1.55, called d1gof_2
  
• d1gofa2 appears in SCOPe 2.04
  
• d1gofa2 appears in SCOPe 2.06
  
• d1gofa2 appears in the current release, SCOPe 2.08