Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Hemapoetic cell kinase Hck [50062] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
Domain d3vs1a1: 3vs1 A:86-146 [218064] Other proteins in same PDB: d3vs1a2, d3vs1a3, d3vs1a4, d3vs1b2, d3vs1b3, d3vs1b4 automated match to d1qcfa1 complexed with ca, cl, vsa |
PDB Entry: 3vs1 (more details), 2.46 Å
SCOPe Domain Sequences for d3vs1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs1a1 b.34.2.1 (A:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle t
Timeline for d3vs1a1:
View in 3D Domains from other chains: (mouse over for more information) d3vs1b1, d3vs1b2, d3vs1b3, d3vs1b4 |