| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Hemapoetic cell kinase Hck [50062] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
| Domain d3vryb1: 3vry B:86-146 [218049] Other proteins in same PDB: d3vrya2, d3vrya3, d3vrya4, d3vryb2, d3vryb3, d3vryb4 automated match to d1qcfa1 complexed with b43, ca, cl |
PDB Entry: 3vry (more details), 2.48 Å
SCOPe Domain Sequences for d3vryb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vryb1 b.34.2.1 (B:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t
Timeline for d3vryb1:
View in 3DDomains from other chains: (mouse over for more information) d3vrya1, d3vrya2, d3vrya3, d3vrya4 |