| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Hemopoetic cell kinase Hck [55565] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
| Domain d3vryb2: 3vry B:147-249 [218050] Other proteins in same PDB: d3vrya1, d3vrya3, d3vrya4, d3vryb1, d3vryb3, d3vryb4 automated match to d1qcfa2 complexed with b43, ca, cl |
PDB Entry: 3vry (more details), 2.48 Å
SCOPe Domain Sequences for d3vryb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vryb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d3vryb2:
View in 3DDomains from other chains: (mouse over for more information) d3vrya1, d3vrya2, d3vrya3, d3vrya4 |