Lineage for d3vqbb_ (3vqb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886120Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)
  8. 2886170Domain d3vqbb_: 3vqb B: [218032]
    automated match to d2itga_
    protein/DNA complex; complexed with cd, fbg, so4

Details for d3vqbb_

PDB Entry: 3vqb (more details), 2.1 Å

PDB Description: HIV-1 IN core domain in complex with 6-fluoro-4H-1,3-benzodioxine-8-carboxylic acid
PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3vqbb_:

Sequence, based on SEQRES records: (download)

>d3vqbb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d3vqbb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqeesmnkelkkiigqvrdqaehlktavqmavfihnhkrkg
giggysagerivdiiatdiq

SCOPe Domain Coordinates for d3vqbb_:

Click to download the PDB-style file with coordinates for d3vqbb_.
(The format of our PDB-style files is described here.)

Timeline for d3vqbb_: