| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries) |
| Domain d3vpfe1: 3vpf E:5-150 [217991] Other proteins in same PDB: d3vpfa2, d3vpfb2, d3vpfc2, d3vpfd2, d3vpfe2, d3vpff2 automated match to d1llca1 complexed with pyr, so4; mutant |
PDB Entry: 3vpf (more details), 2.79 Å
SCOPe Domain Sequences for d3vpfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpfe1 c.2.1.5 (E:5-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspk
kiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflva
anpvdiltyatwklsgfpknrvvgsg
Timeline for d3vpfe1: