Lineage for d1b6ua1 (1b6u A:5-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753801Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753807Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 2753812Domain d1b6ua1: 1b6u A:5-103 [21797]

Details for d1b6ua1

PDB Entry: 1b6u (more details), 3 Å

PDB Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
PDB Compounds: (A:) p58 killer cell inhibitory receptor

SCOPe Domain Sequences for d1b6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ua1 b.1.1.4 (A:5-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
hrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvskanf
sigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOPe Domain Coordinates for d1b6ua1:

Click to download the PDB-style file with coordinates for d1b6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1b6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6ua2