Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Killer cell inhibitory receptor [49202] (4 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries) |
Domain d1b6ua2: 1b6u A:104-203 [21798] |
PDB Entry: 1b6u (more details), 3 Å
SCOPe Domain Sequences for d1b6ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6ua2 b.1.1.4 (A:104-203) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]} lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeaherrfsagpkvngtfqad fplgpathggtyrcfgsfrdspyewsnssdpllvsvtgnp
Timeline for d1b6ua2: