SCOPe 2.04: Domain d3vo2a1: 3vo2 A:19-154

Lineage for d3vo2a1 (3vo2 A:19-154)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226539] (5 PDB entries)

8. Domain d3vo2a1: 3vo2 A:19-154 [217949]
   Other proteins in same PDB: d3vo2a2, d3vo2b1, d3vo2b2
   automated match to d1frna1
   complexed with fad

Details for d3vo2a1

PDB Entry: 3vo2, 1.39 Å

PDB Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3vo2a1:

Sequence; same for both SEQRES and ATOM records:

>d3vo2a1 b.43.4.0 (A:19-154) automated matches {Maize (Zea mays) [TaxId: 4577]}
tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
lkpgadvkitgpvgke

Timeline for d3vo2a1:

• d3vo2a1 first appeared in SCOPe 2.03
  
• d3vo2a1 appears in SCOPe 2.05
  
• d3vo2a1 appears in the current release, SCOPe 2.08