Lineage for d3vo2a1 (3vo2 A:19-154)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317445Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1317611Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 1317612Protein automated matches [226870] (15 species)
    not a true protein
  7. 1317662Species Maize (Zea mays) [TaxId:4577] [226539] (5 PDB entries)
  8. 1317664Domain d3vo2a1: 3vo2 A:19-154 [217949]
    Other proteins in same PDB: d3vo2a2, d3vo2b1, d3vo2b2
    automated match to d1frna1
    complexed with fad

Details for d3vo2a1

PDB Entry: 3vo2 (more details), 1.39 Å

PDB Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3vo2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vo2a1 b.43.4.0 (A:19-154) automated matches {Maize (Zea mays) [TaxId: 4577]}
tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
lkpgadvkitgpvgke

SCOPe Domain Coordinates for d3vo2a1:

Click to download the PDB-style file with coordinates for d3vo2a1.
(The format of our PDB-style files is described here.)

Timeline for d3vo2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vo2a2