Lineage for d1cs6a2 (1cs6 A:104-208)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 222108Family b.1.1.4: I set domains [49159] (27 proteins)
  6. 222109Protein Axonin-1 [49184] (1 species)
    tandem repeat of 4 L1 domains
  7. 222110Species Chicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)
  8. 222112Domain d1cs6a2: 1cs6 A:104-208 [21761]

Details for d1cs6a2

PDB Entry: 1cs6 (more details), 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken

SCOP Domain Sequences for d1cs6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus)}
gflqefsaeerdpvkitegwgvmftcsppphypalsyrwllnefpnfipadgrrfvsqtt
gnlyiakteasdlgnyscfatshidfitksvfskfsqlslaaeda

SCOP Domain Coordinates for d1cs6a2:

Click to download the PDB-style file with coordinates for d1cs6a2.
(The format of our PDB-style files is described here.)

Timeline for d1cs6a2: