Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (27 proteins) |
Protein Axonin-1 [49184] (1 species) tandem repeat of 4 L1 domains |
Species Chicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry) |
Domain d1cs6a2: 1cs6 A:104-208 [21761] |
PDB Entry: 1cs6 (more details), 1.8 Å
SCOP Domain Sequences for d1cs6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus)} gflqefsaeerdpvkitegwgvmftcsppphypalsyrwllnefpnfipadgrrfvsqtt gnlyiakteasdlgnyscfatshidfitksvfskfsqlslaaeda
Timeline for d1cs6a2: