![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) ![]() |
![]() | Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein) |
![]() | Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species) pentameric coiled-coil |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries) |
![]() | Domain d3v2nc_: 3v2n C: [217609] automated match to d1mz9a_ complexed with myr |
PDB Entry: 3v2n (more details), 1.8 Å
SCOPe Domain Sequences for d3v2nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v2nc_ h.1.7.1 (C:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
Timeline for d3v2nc_:
![]() Domains from other chains: (mouse over for more information) d3v2na_, d3v2nb_, d3v2nd_, d3v2ne_ |