PDB entry 3v2n
View 3v2n on RCSB PDB site
Description: COMPcc in complex with fatty acids
Class: protein binding
Keywords: coiled coil fatty acids, storage, PROTEIN BINDING
Deposited on
2011-12-12, released
2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated
2013-03-20, with a file datestamp of
2013-03-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3v2na_ - Chain 'B':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3v2nb_ - Chain 'C':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3v2nc_ - Chain 'D':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3v2nd_ - Chain 'E':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3v2ne_ - Heterogens: MYR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2nA (A:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2nB (B:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2nC (C:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2nD (D:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2nE (E:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac