Lineage for d3v1zb_ (3v1z B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604328Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins)
    automatically mapped to Pfam PF07832
  6. 1604329Protein Restriction endonuclease Bse634I [69523] (1 species)
  7. 1604330Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries)
  8. 1604334Domain d3v1zb_: 3v1z B: [217601]
    automated match to d3v21h_
    protein/DNA complex

Details for d3v1zb_

PDB Entry: 3v1z (more details), 2.2 Å

PDB Description: Crystal structure of Type IIF restriction endonuclease Bse634I with cognate DNA
PDB Compounds: (B:) Endonuclease Bse634IR

SCOPe Domain Sequences for d3v1zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v1zb_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]}
nltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgl
aiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrek
lhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdie
gkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygassep
vskadddalqtaathtivnvnstperavddifsltsfedidkmldqiik

SCOPe Domain Coordinates for d3v1zb_:

Click to download the PDB-style file with coordinates for d3v1zb_.
(The format of our PDB-style files is described here.)

Timeline for d3v1zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3v1za_