| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins) automatically mapped to Pfam PF07832 |
| Protein Restriction endonuclease Bse634I [69523] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries) |
| Domain d3v1zb_: 3v1z B: [217601] automated match to d3v21h_ protein/DNA complex |
PDB Entry: 3v1z (more details), 2.2 Å
SCOPe Domain Sequences for d3v1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v1zb_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]}
nltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgl
aiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrek
lhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdie
gkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygassep
vskadddalqtaathtivnvnstperavddifsltsfedidkmldqiik
Timeline for d3v1zb_: