Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (7 PDB entries) |
Domain d1e0ob2: 1e0o B:251-360 [21749] Other proteins in same PDB: d1e0oa_, d1e0oc_ complexed with ni, so4 |
PDB Entry: 1e0o (more details), 2.8 Å
SCOPe Domain Sequences for d1e0ob2:
Sequence, based on SEQRES records: (download)
>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl
>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhlkvlkaagvnttdkeie vlyirnvtfedageytclagnsigisfhsawltvl
Timeline for d1e0ob2:
View in 3D Domains from other chains: (mouse over for more information) d1e0oa_, d1e0oc_, d1e0od1, d1e0od2 |