SCOPe 2.08: Domain d1e0ob2: 1e0o B:251-360

Lineage for d1e0ob2 (1e0o B:251-360)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)

8. Domain d1e0ob2: 1e0o B:251-360 [21749]
   Other proteins in same PDB: d1e0oa_, d1e0oc_
   complexed with ni, so4

Details for d1e0ob2

PDB Entry: 1e0o, 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex

PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1e0ob2:

Sequence, based on SEQRES records:

>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records):

>d1e0ob2 b.1.1.4 (B:251-360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhlkvlkaagvnttdkeie
vlyirnvtfedageytclagnsigisfhsawltvl

Timeline for d1e0ob2:

• d1e0ob2 first appeared (with stable ids) in SCOP 1.55
  
• d1e0ob2 appears in SCOPe 2.07