Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.0: automated matches [227303] (1 protein) not a true family |
Protein automated matches [227129] (1 species) not a true protein |
Species Thermus aquaticus [TaxId:271] [226811] (1 PDB entry) |
Domain d3ufxf2: 3ufx F:122-288 [217357] Other proteins in same PDB: d3ufxa1, d3ufxd1, d3ufxf1, d3ufxh1 automated match to d2scua2 complexed with gdp, mn |
PDB Entry: 3ufx (more details), 2.35 Å
SCOPe Domain Sequences for d3ufxf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ufxf2 c.23.4.0 (F:122-288) automated matches {Thermus aquaticus [TaxId: 271]} ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
Timeline for d3ufxf2: