Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Thermus aquaticus [TaxId:271] [226411] (1 PDB entry) |
Domain d3ufxd1: 3ufx D:1-121 [217354] Other proteins in same PDB: d3ufxa2, d3ufxd2, d3ufxf2, d3ufxh2 automated match to d1jkja1 complexed with gdp, mn |
PDB Entry: 3ufx (more details), 2.35 Å
SCOPe Domain Sequences for d3ufxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ufxd1 c.2.1.0 (D:1-121) automated matches {Thermus aquaticus [TaxId: 271]} milvnketrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeav ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig g
Timeline for d3ufxd1: